PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_6DL_6BFC1BFFF.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family FAR1
Protein Properties Length: 261aa    MW: 28508.7 Da    PI: 4.9678
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_6DL_6BFC1BFFF.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR169.86.7e-22127248290
                   FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkk..................................tekerrtr 55 
                             Yn+Y+ ++GFs+++++ +k  ++ge +k++fvC+k  k++ ++                                    ++k+r++ 
  Traes_6DL_6BFC1BFFF.2 127 HYNAYSLQMGFSIKMNSARKDMKTGELVKQQFVCNKFRKPHVDDGGaekipvlddiieqakddnedeaivfldddskgkkRSKKRKRD 214
                            6************************************99999988899******************************9888999999 PP

                   FAR1  56 aetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                            +  +tgCkak+ vk   dg+wev+ ++ eHnH+l+
  Traes_6DL_6BFC1BFFF.2 215 KIVQTGCKAKMIVKVI-DGRWEVIYFVGEHNHPLV 248
                            9***************.****************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031014.3E-20127248IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MIDLNEEPAE NNGDPFYCTQ HAAGNVEFVV ESPNPPIMQR VNAAATEAME TDGQSSRGGR  60
APGSTQVPAA VAAGSDAHTL DGTGAAGDTG GTVGNGLGAE NDDEAWSQPK EPYVGMRFDT  120
LEDAKEHYNA YSLQMGFSIK MNSARKDMKT GELVKQQFVC NKFRKPHVDD GGAEKIPVLD  180
DIIEQAKDDN EDEAIVFLDD DSKGKKRSKK RKRDKIVQTG CKAKMIVKVI DGRWEVIYFV  240
GEHNHPLVDK PSLTKYLPSH Q
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014756032.13e-52PREDICTED: protein FAR-RED ELONGATED HYPOCOTYL 3-like
TrEMBLW5GWZ70.0W5GWZ7_WHEAT; Uncharacterized protein
STRINGMLOC_28634.11e-135(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP9528843
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G07500.12e-12FAR1 family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]